PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G184000.1
Common NamePHAVU_006G184000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Dof
Protein Properties Length: 346aa    MW: 37332.6 Da    PI: 8.4721
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G184000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.32e-3954112361
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +++lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Phvul.006G184000.1  54 QQSLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 112
                         7899*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.7E-3455111IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-2756111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52557111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSGNCEKMVV IPPTTNQWPQ VDDEKVLMGS FSGSKNSKVM EKADQEVLQQ QLQQQSLKCP  60
RCDSSNTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV PVGGGCRKNK RLKRPITISS  120
SAAIETASSS NSSALTAASQ PQIDTASTSL FYGLPSSSTD VNLPLVPRFG SRISTSRFDL  180
QLNNALGLGF SSNEASENNS FRNGFGSNNA LLSSYNSIFG SSSSSTSTTP AMSSLLSSTF  240
LQHKFIGCGL KDGVDSNTFQ HGLGLTPLEQ LQMSSDNSEA GMVALKDVKV ELGQNNRLEW  300
NGACQNQIQH VGMYDPSLYW NNSATALGVW SDQAANIGSS VTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148145.10.0hypothetical protein PHAVU_006G184000g
TrEMBLV7BQA00.0V7BQA0_PHAVU; Uncharacterized protein
STRINGGLYMA13G31100.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.13e-37Dof family protein